AB-P5848
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 10 ug |
Gene Name | NKIRAS1 |
Gene Alias | KBRAS1|kappaB-Ras1 |
Gene Description | NFKB inhibitor interacting Ras-like 1 |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed. |
Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT). |
Gene ID | 28512 |