NKIRAS1 (Human) Recombinant Protein
  • NKIRAS1 (Human) Recombinant Protein

NKIRAS1 (Human) Recombinant Protein

Ref: AB-P5848
NKIRAS1 (Human) Recombinant Protein

Información del producto

Human NKIRAS1 (NP_065078, 1 a.a. - 192 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name NKIRAS1
Gene Alias KBRAS1|kappaB-Ras1
Gene Description NFKB inhibitor interacting Ras-like 1
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGKGCKVVVCGLLSVGKTAILEQLLYGNHTIGMEDCETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLVYSVNNLESFQRVELLKKEIDKFKDKKEVAIVVLGNKIDLSEQRQVDAEVAQQWAKSEKVRLWEVTVTDRKTLIEPFTLLASKLSQPQSKSSFPLPGRKNKGNSNSEN
Form Liquid
Antigen species Target species Human
Quality control testing 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT).
Gene ID 28512

Enviar uma mensagem


NKIRAS1 (Human) Recombinant Protein

NKIRAS1 (Human) Recombinant Protein