Ver mas grande
LSM2 (Human) Recombinant Protein
AB-P5391
Producto nuevo
LSM2 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | LSM2 |
| Gene Alias | C6orf28|G7b|YBL026W|snRNP |
| Gene Description | LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (5 mM DTT, 40% glycerol). |
| Gene ID | 57819 |
Más información
Human LSM2 (NP_067000, 1 a.a. - 95 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.