LSM2 (Human) Recombinant Protein
  • LSM2 (Human) Recombinant Protein

LSM2 (Human) Recombinant Protein

Ref: AB-P5391
LSM2 (Human) Recombinant Protein

Información del producto

Human LSM2 (NP_067000, 1 a.a. - 95 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name LSM2
Gene Alias C6orf28|G7b|YBL026W|snRNP
Gene Description LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
Form Liquid
Antigen species Target species Human
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In 20 mM Tris-HCl buffer, 200 mM NaCl, pH 8.0 (5 mM DTT, 40% glycerol).
Gene ID 57819

Enviar uma mensagem


LSM2 (Human) Recombinant Protein

LSM2 (Human) Recombinant Protein