GST (iSchistosoma japonicum/i) Recombinant Protein
  • GST (iSchistosoma japonicum/i) Recombinant Protein

GST (iSchistosoma japonicum/i) Recombinant Protein

Ref: AB-P4988
GST (Schistosoma japonicum) Recombinant Protein

Información del producto

Schistosoma japonicum GST (NP_ P08515, 1 a.a. - 224 a.a.) full-length recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR
Form Liquid
Antigen species Target species S. japonicum
Quality control testing Loading 3 ug protein in 15% SDS-PAGE
Storage Buffer In PBS, pH 7.4.

Enviar un mensaje


GST (iSchistosoma japonicum/i) Recombinant Protein

GST (iSchistosoma japonicum/i) Recombinant Protein