View larger
<i>Schistosoma japonicum</i> GST (NP_ P08515, 1 a.a. - 224 a.a.) full-length recombinant protein expressed in <i>Escherichia col
AB-P4988
New product
GST (Schistosoma japonicum) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR |
| Form | Liquid |
| Antigen species Target species | S. japonicum |
| Quality control testing | Loading 3 ug protein in 15% SDS-PAGE |
| Storage Buffer | In PBS, pH 7.4. |
More info
Schistosoma japonicum GST (NP_ P08515, 1 a.a. - 224 a.a.) full-length recombinant protein expressed in Escherichia coli.