Ver mas grande
coaA (iEscherichia coli/i) Recombinant protein
AB-P4959
Producto nuevo
coaA (Escherichia coli) Recombinant protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | coaA |
| Gene Alias | ECK3966|JW3942|panK|rts|ts-9 |
| Gene Description | pantothenate kinase |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 1 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDA |
| Form | Liquid |
| Antigen species Target species | Escherichia coli |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, , 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol). |
| Gene ID | 948479 |
Más información
Escherichia coli coaA (NP_418405, 1 a.a. - 316 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.