coaA (<i>Escherichia coli</i>) Recombinant protein
  • coaA (<i>Escherichia coli</i>) Recombinant protein

coaA (<i>Escherichia coli</i>) Recombinant protein

Ref: AB-P4959
coaA (Escherichia coli) Recombinant protein

Información del producto

Escherichia coli coaA (NP_418405, 1 a.a. - 316 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name coaA
Gene Alias ECK3966|JW3942|panK|rts|ts-9
Gene Description pantothenate kinase
Storage Conditions Store at 2C to 8C for 1 week. For long term storage, aliquot and store at -20C to -80C.
Aliquot to avoid repeated freezing and thawing.
Concentration 1 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq MGSSHHHHHHSSGLVPRGSHMGSHMSIKEQTLMTPYLQFDRNQWAALRDSVPMTLSEDEIARLKGINEDLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTTARVLQALLSRWPEHRRVELITTDGFLHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVPNVTAPVYSHLIYDVIPDGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDA
Form Liquid
Antigen species Target species Escherichia coli
Quality control testing 15% SDS-PAGE Stained with Coomassie Blue
Storage Buffer In 20 mM Tris-HCl buffer, , 200 mM NaCl, pH 8.0 (2 mM DTT, 10% glycerol).
Gene ID 948479

Enviar uma mensagem


coaA (<i>Escherichia coli</i>) Recombinant protein

coaA (<i>Escherichia coli</i>) Recombinant protein