BTLA (Human) Recombinant Protein
  • BTLA (Human) Recombinant Protein

BTLA (Human) Recombinant Protein

Ref: AB-P4939
BTLA (Human) Recombinant Protein

Información del producto

Human BTLA Recombinant protein fused to murine IgG2a Fc and hinge region purifird from CHO cells.
Información adicional
Size 25 ug
Gene Name BTLA
Gene Alias BTLA1|CD272|FLJ16065|MGC129743
Gene Description B and T lymphocyte associated
Storage Conditions Store at 4C. This product is stable for at least 3 months.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq BTLA mature: ipyldiwnihgkescdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeeknisffilhfepvlpndngsyrcsanfqsnli eshsttlyvtdvksaserpskdemasrp
Linker +Murine IgG2a Hinge + Fc: gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnve
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate)
Gene ID 151888

Enviar un mensaje


BTLA (Human) Recombinant Protein

BTLA (Human) Recombinant Protein