View larger
Human BTLA Recombinant protein fused to murine IgG2a Fc and hinge region purifird from CHO cells.
AB-P4939
New product
BTLA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 6 pontos de fidelização. Seu carrinho totalizará 6 pontos de fidelização que podem ser convertidos num vale de desconto de 24.00EUR.
Data sheet
| Size | 25 ug |
| Gene Name | BTLA |
| Gene Alias | BTLA1|CD272|FLJ16065|MGC129743 |
| Gene Description | B and T lymphocyte associated |
| Storage Conditions | Store at 4ºC. This product is stable for at least 3 months. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | BTLA mature: ipyldiwnihgkescdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeeknisffilhfepvlpndngsyrcsanfqsnli eshsttlyvtdvksaserpskdemasrp<br>Linker +Murine IgG2a Hinge + Fc: gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnve |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate) |
| Gene ID | 151888 |
More info
Human BTLA Recombinant protein fused to murine IgG2a Fc and hinge region purifird from CHO cells.