Ver mas grande
TNFRSF4 (Human) Recombinant Protein
AB-P4934
Producto nuevo
TNFRSF4 (Human) Recombinant Protein
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | TNFRSF4 |
| Gene Alias | ACT35|CD134|OX40|TXGP1L |
| Gene Description | tumor necrosis factor receptor superfamily, member 4 |
| Storage Conditions | Store at 4ºC. This product is stable for at least 3 months. |
| Concentration | 0.5 mg/mL |
| Application Key | SDS-PAGE |
| Immunogen Prot. Seq | TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr<br>Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppk |
| Form | Liquid |
| Antigen species Target species | Human |
| Storage Buffer | In 50 mM sodium phosphate, 100 mM NaCl, pH 7.6. (0.5 mg/mL gentamicin sulfate) |
| Gene ID | 7293 |
Más información
Human TNFRSF4 Recombinant protein fused to murine IgG2a Fc purifird from CHO cells.