TNFRSF4 (Human) Recombinant Protein
  • TNFRSF4 (Human) Recombinant Protein

TNFRSF4 (Human) Recombinant Protein

Ref: AB-P4934
TNFRSF4 (Human) Recombinant Protein

Información del producto

Human TNFRSF4 Recombinant protein fused to murine IgG2a Fc purifird from CHO cells.
Información adicional
Size 25 ug
Gene Name TNFRSF4
Gene Alias ACT35|CD134|OX40|TXGP1L
Gene Description tumor necrosis factor receptor superfamily, member 4
Storage Conditions Store at 4C. This product is stable for at least 3 months.
Concentration 0.5 mg/mL
Application Key SDS-PAGE
Immunogen Prot. Seq TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr
Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppk
Form Liquid
Antigen species Target species Human
Storage Buffer In 50 mM sodium phosphate, 100 mM NaCl, pH 7.6. (0.5 mg/mL gentamicin sulfate)
Gene ID 7293

Enviar uma mensagem


TNFRSF4 (Human) Recombinant Protein

TNFRSF4 (Human) Recombinant Protein