Ver mas grande
CXCL12 (Beta) (Cat) Recombinant protein
AB-P4854
Producto nuevo
CXCL12 (Beta) (Cat) Recombinant protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | CXCL12 |
| Gene Alias | SDF-1 |
| Gene Description | chemokine (C-X-C motif) ligand 12 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Form | Lyophilized |
| Antigen species Target species | Cat |
| Storage Buffer | No additive |
| Gene ID | 493806 |
Más información
Feline CXCL12 (beta) recombinant protein expressed in Escherichia coli.