View larger
Feline CXCL12 (beta) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4854
New product
CXCL12 (Beta) (Cat) Recombinant protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | CXCL12 |
| Gene Alias | SDF-1 |
| Gene Description | chemokine (C-X-C motif) ligand 12 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Form | Lyophilized |
| Antigen species Target species | Cat |
| Storage Buffer | No additive |
| Gene ID | 493806 |
More info
Feline CXCL12 (beta) recombinant protein expressed in Escherichia coli.