Kitlg (Rat) Recombinant Protein Ver mas grande

Kitlg (Rat) Recombinant Protein

AB-P4851

Producto nuevo

Kitlg (Rat) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name Kitlg
Gene Alias Kitl|Mgf|SCF
Gene Description KIT ligand
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized 10 mM acetic acid, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 60427

Más información

Rat Kitlg recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein