Kitlg (Rat) Recombinant Protein
  • Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein

Ref: AB-P4851
Kitlg (Rat) Recombinant Protein

Información del producto

Rat Kitlg recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Kitlg
Gene Alias Kitl|Mgf|SCF
Gene Description KIT ligand
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized 10 mM acetic acid, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MQEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer No additive
Gene ID 60427

Enviar uma mensagem


Kitlg (Rat) Recombinant Protein

Kitlg (Rat) Recombinant Protein