Ver mas grande
Lep (Rat) Recombinant Protein
AB-P4847
Producto nuevo
Lep (Rat) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 1 mg |
| Gene Name | Lep |
| Gene Alias | OB|obese |
| Gene Description | leptin |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue |
| Storage Buffer | Lyophilized from 0.1% TFA |
| Gene ID | 25608 |
Más información
Rat Lep recombinant protein expressed in Escherichia coli.