Lep (Rat) Recombinant Protein
  • Lep (Rat) Recombinant Protein

Lep (Rat) Recombinant Protein

Ref: AB-P4847
Lep (Rat) Recombinant Protein

Información del producto

Rat Lep recombinant protein expressed in Escherichia coli.
Información adicional
Size 1 mg
Gene Name Lep
Gene Alias OB|obese
Gene Description leptin
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer Lyophilized from 0.1% TFA
Gene ID 25608

Enviar uma mensagem


Lep (Rat) Recombinant Protein

Lep (Rat) Recombinant Protein