Ver mas grande
Il1b (Rat) Recombinant Protein
AB-P4841
Producto nuevo
Il1b (Rat) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Il1b |
| Gene Alias | - |
| Gene Description | interleukin 1 beta |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Form | Lyophilized |
| Antigen species Target species | Rat |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue |
| Storage Buffer | Lyophilized from 10 mM NaP, pH 7.5 |
| Gene ID | 24494 |
Más información
Rat Il1b recombinant protein expressed in Escherichia coli.