Il1b (Rat) Recombinant Protein
  • Il1b (Rat) Recombinant Protein

Il1b (Rat) Recombinant Protein

Ref: AB-P4841
Il1b (Rat) Recombinant Protein

Información del producto

Rat Il1b recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Il1b
Gene Alias -
Gene Description interleukin 1 beta
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer Lyophilized from 10 mM NaP, pH 7.5
Gene ID 24494

Enviar uma mensagem


Il1b (Rat) Recombinant Protein

Il1b (Rat) Recombinant Protein