Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Protein
Csf2 (Rat) Recombinant Protein
Abnova
Csf2 (Rat) Recombinant Protein
Ref: AB-P4838
Csf2 (Rat) Recombinant Protein
Contáctenos
Información del producto
Rat Csf2 recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
Csf2
Gene Alias
Gm-csf|Gmcsf
Gene Description
colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Form
Lyophilized
Antigen species Target species
Rat
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer
Lyophilized from 20 mM NaHCO
3
Gene ID
116630
Enviar un mensaje
Csf2 (Rat) Recombinant Protein
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*