Csf2 (Rat) Recombinant Protein
  • Csf2 (Rat) Recombinant Protein

Csf2 (Rat) Recombinant Protein

Ref: AB-P4838
Csf2 (Rat) Recombinant Protein

Información del producto

Rat Csf2 recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name Csf2
Gene Alias Gm-csf|Gmcsf
Gene Description colony stimulating factor 2 (granulocyte-macrophage)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSIQRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCEIEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Form Lyophilized
Antigen species Target species Rat
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Storage Buffer Lyophilized from 20 mM NaHCO3
Gene ID 116630

Enviar uma mensagem


Csf2 (Rat) Recombinant Protein

Csf2 (Rat) Recombinant Protein