Ver mas grande
Pdgfa/Pdgfa (Mouse) Recombinant Protein
AB-P4802
Producto nuevo
Pdgfa/Pdgfa (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | Pdgfa |
| Gene Alias | - |
| Gene Description | platelet derived growth factor, alpha |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | No additive |
| Gene ID | 18590 |
Más información
Mouse Pdgfa (homodimer) recombinant protein expressed in Escherichia coli.