Pdgfa/Pdgfa (Mouse) Recombinant Protein
  • Pdgfa/Pdgfa (Mouse) Recombinant Protein

Pdgfa/Pdgfa (Mouse) Recombinant Protein

Ref: AB-P4802
Pdgfa/Pdgfa (Mouse) Recombinant Protein

Información del producto

Mouse Pdgfa (homodimer) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Pdgfa
Gene Alias -
Gene Description platelet derived growth factor, alpha
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer No additive
Gene ID 18590

Enviar uma mensagem


Pdgfa/Pdgfa (Mouse) Recombinant Protein

Pdgfa/Pdgfa (Mouse) Recombinant Protein