Il13 (Mouse) Recombinant Protein Ver mas grande

Il13 (Mouse) Recombinant Protein

AB-P4602

Producto nuevo

Il13 (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 10 ug
Gene Name Il13
Gene Alias Il-13
Gene Description interleukin 13
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer No additive
Gene ID 16163

Más información

Mouse Il13 (P20109) recombinant protein expressed in Escherichia coli.

Consulta sobre un producto

Il13 (Mouse) Recombinant Protein

Il13 (Mouse) Recombinant Protein