View larger
Mouse Il13 (P20109) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4602
New product
Il13 (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | Il13 |
| Gene Alias | Il-13 |
| Gene Description | interleukin 13 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Storage Buffer | No additive |
| Gene ID | 16163 |
More info
Mouse Il13 (P20109) recombinant protein expressed in Escherichia coli.