Ntf3 (Mouse) Recombinant Protein
  • Ntf3 (Mouse) Recombinant Protein

Ntf3 (Mouse) Recombinant Protein

Ref: AB-P4601
Ntf3 (Mouse) Recombinant Protein

Información del producto

Mouse Ntf3 (P20181) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name Ntf3
Gene Alias AI316846|AI835689|NT-3|NT3|Ntf-3
Gene Description neurotrophin 3
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 0.02% TFA.
Gene ID 18205

Enviar un mensaje


Ntf3 (Mouse) Recombinant Protein

Ntf3 (Mouse) Recombinant Protein