Ntf3 (Mouse) Recombinant Protein View larger

Mouse Ntf3 (P20181) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4601

New product

Ntf3 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name Ntf3
Gene Alias AI316846|AI835689|NT-3|NT3|Ntf-3
Gene Description neurotrophin 3
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEIKTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRWIRIDTSCVCALSRKIGRT
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 0.02% TFA.
Gene ID 18205

More info

Mouse Ntf3 (P20181) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Ntf3 (P20181) recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Ntf3 (P20181) recombinant protein expressed in <i>Escherichia coli</i>.