Ifng (Mouse) Recombinant Protein
  • Ifng (Mouse) Recombinant Protein

Ifng (Mouse) Recombinant Protein

Ref: AB-P4596
Ifng (Mouse) Recombinant Protein

Información del producto

Mouse Ifng (P01580) recombinant protein expressed in Escherichia coli.
Información adicional
Size 100 ug
Gene Name Ifng
Gene Alias IFN-g|IFN-gamma|Ifg
Gene Description interferon gamma
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized with 0.5X PBS, pH 7.2.
Gene ID 15978

Enviar un mensaje


Ifng (Mouse) Recombinant Protein

Ifng (Mouse) Recombinant Protein