Ifng (Mouse) Recombinant Protein View larger

Mouse Ifng (P01580) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4596

New product

Ifng (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name Ifng
Gene Alias IFN-g|IFN-gamma|Ifg
Gene Description interferon gamma
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Form Lyophilized
Antigen species Target species Mouse
Storage Buffer Lyophilized with 0.5X PBS, pH 7.2.
Gene ID 15978

More info

Mouse Ifng (P01580) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Ifng (P01580) recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Ifng (P01580) recombinant protein expressed in <i>Escherichia coli</i>.