Ver mas grande
Fgf2 (Mouse) Recombinant Protein
AB-P4592
Producto nuevo
Fgf2 (Mouse) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | Fgf2 |
| Gene Alias | Fgf-2|Fgfb|bFGF |
| Gene Description | fibroblast growth factor 2 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Form | Lyophilized |
| Antigen species Target species | Mouse |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from 5 mM Na<sub>2</sub>PO<sub>4, 50 mM NaCl, pH 7.5. |
| Gene ID | 14173 |
Más información
Mouse Fgf2 (P15655) recombinant protein expressed in Escherichia coli.