Fgf2 (Mouse) Recombinant Protein
  • Fgf2 (Mouse) Recombinant Protein

Fgf2 (Mouse) Recombinant Protein

Ref: AB-P4592
Fgf2 (Mouse) Recombinant Protein

Información del producto

Mouse Fgf2 (P15655) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name Fgf2
Gene Alias Fgf-2|Fgfb|bFGF
Gene Description fibroblast growth factor 2
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 5 mM Na2PO4, 50 mM NaCl, pH 7.5.
Gene ID 14173

Enviar uma mensagem


Fgf2 (Mouse) Recombinant Protein

Fgf2 (Mouse) Recombinant Protein