Fgf2 (Mouse) Recombinant Protein View larger

Mouse Fgf2 (P15655) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4592

New product

Fgf2 (Mouse) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 ug
Gene Name Fgf2
Gene Alias Fgf-2|Fgfb|bFGF
Gene Description fibroblast growth factor 2
Storage Conditions Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Form Lyophilized
Antigen species Target species Mouse
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from 5 mM Na<sub>2</sub>PO<sub>4, 50 mM NaCl, pH 7.5.
Gene ID 14173

More info

Mouse Fgf2 (P15655) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Mouse Fgf2 (P15655) recombinant protein expressed in <i>Escherichia coli</i>.

Mouse Fgf2 (P15655) recombinant protein expressed in <i>Escherichia coli</i>.