IL22 (Human) Recombinant Protein
  • IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein

Ref: AB-P4580
IL22 (Human) Recombinant Protein

Información del producto

Human IL22 (Q9GZX6) recombinant protein expressed in Escherichia coli.
Información adicional
Size 10 ug
Gene Name IL22
Gene Alias IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description interleukin 22
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 10 mM sodium citrate, pH 3.0.
Gene ID 50616

Enviar un mensaje


IL22 (Human) Recombinant Protein

IL22 (Human) Recombinant Protein