Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
IL22 (Human) Recombinant Protein
Abnova
IL22 (Human) Recombinant Protein
Ref: AB-P4580
IL22 (Human) Recombinant Protein
Contacte-nos
Información del producto
Human IL22 (Q9GZX6) recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
10 ug
Gene Name
IL22
Gene Alias
IL-21|IL-22|IL-D110|IL-TIF|IL21|ILTIF|MGC79382|MGC79384|TIFIL-23|TIFa|zcyto18
Gene Description
interleukin 22
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Form
Lyophilized
Antigen species Target species
Human
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer
Lyophilized with 10 mM sodium citrate, pH 3.0.
Gene ID
50616
Enviar uma mensagem
IL22 (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*