AB-P4578
Producto nuevo
Este producto ya no esta disponible
Fecha disponibilidad
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Size | 20 ug |
Gene Name | CTGF |
Gene Alias | CCN2|HCS24|IGFBP8|MGC102839|NOV2 |
Gene Description | connective tissue growth factor |
Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with 5 mM sodium acetate, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
Form | Lyophilized |
Antigen species Target species | Human |
Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
Storage Buffer | Lyophilized with 10 mM sodium acetate, pH 6.0. |
Gene ID | 1490 |