View larger
Human CTGF (P29279) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4578
New product
CTGF (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | CTGF |
| Gene Alias | CCN2|HCS24|IGFBP8|MGC102839|NOV2 |
| Gene Description | connective tissue growth factor |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with 5 mM sodium acetate, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized with 10 mM sodium acetate, pH 6.0. |
| Gene ID | 1490 |
More info
Human CTGF (P29279) recombinant protein expressed in Escherichia coli.