CTGF (Human) Recombinant Protein
  • CTGF (Human) Recombinant Protein

CTGF (Human) Recombinant Protein

Ref: AB-P4578
CTGF (Human) Recombinant Protein

Información del producto

Human CTGF (P29279) recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name CTGF
Gene Alias CCN2|HCS24|IGFBP8|MGC102839|NOV2
Gene Description connective tissue growth factor
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with 5 mM sodium acetate, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 10 mM sodium acetate, pH 6.0.
Gene ID 1490

Enviar uma mensagem


CTGF (Human) Recombinant Protein

CTGF (Human) Recombinant Protein