TGFB1 (Human) Recombinant Protein
  • TGFB1 (Human) Recombinant Protein

TGFB1 (Human) Recombinant Protein

Ref: AB-P4576
TGFB1 (Human) Recombinant Protein

Información del producto

Human TGFB1 (P01137) recombinant protein expressed in HEK293 cells.
Información adicional
Size 20 ug
Gene Name TGFB1
Gene Alias CED|DPD1|TGFB|TGFbeta
Gene Description transforming growth factor, beta 1
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Form Lyophilized
Antigen species Target species Human
Storage Buffer Lyophilized with 10 mM HCl, 50 ug BSA per mg/mL of protein.
Gene ID 7040

Enviar un mensaje


TGFB1 (Human) Recombinant Protein

TGFB1 (Human) Recombinant Protein