View larger
Human TGFB1 (P01137) recombinant protein expressed in HEK293 cells.
AB-P4576
New product
TGFB1 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 5 pontos de fidelização. Seu carrinho totalizará 5 pontos de fidelização que podem ser convertidos num vale de desconto de 20.00EUR.
Data sheet
| Size | 20 ug |
| Gene Name | TGFB1 |
| Gene Alias | CED|DPD1|TGFB|TGFbeta |
| Gene Description | transforming growth factor, beta 1 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | Lyophilized with 10 mM HCl, 50 ug BSA per mg/mL of protein. |
| Gene ID | 7040 |
More info
Human TGFB1 (P01137) recombinant protein expressed in HEK293 cells.