TNFRSF1A (Human) Recombinant Protein
  • TNFRSF1A (Human) Recombinant Protein

TNFRSF1A (Human) Recombinant Protein

Ref: AB-P4575
TNFRSF1A (Human) Recombinant Protein

Información del producto

Human TNFRSF1A recombinant protein expressed in Escherichia coli.
Información adicional
Size 20 ug
Gene Name TNFRSF1A
Gene Alias CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene Description tumor necrosis factor receptor superfamily, member 1A
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized with 10 mM Na2PO4, pH 7.5.
Gene ID 7132

Enviar un mensaje


TNFRSF1A (Human) Recombinant Protein

TNFRSF1A (Human) Recombinant Protein