Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Protein
TNFRSF1A (Human) Recombinant Protein
Abnova
TNFRSF1A (Human) Recombinant Protein
Ref: AB-P4575
TNFRSF1A (Human) Recombinant Protein
Contacte-nos
Información del producto
Human TNFRSF1A recombinant protein expressed in
Escherichia coli
.
Información adicional
Size
20 ug
Gene Name
TNFRSF1A
Gene Alias
CD120a|FPF|MGC19588|TBP1|TNF-R|TNF-R-I|TNF-R55|TNFAR|TNFR1|TNFR55|TNFR60|p55|p55-R|p60
Gene Description
tumor necrosis factor receptor superfamily, member 1A
Storage Conditions
Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key
Func,SDS-PAGE
Immunogen Prot. Seq
MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
Form
Lyophilized
Antigen species Target species
Human
Quality control testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer
Lyophilized with 10 mM Na
2
PO
4
, pH 7.5.
Gene ID
7132
Enviar uma mensagem
TNFRSF1A (Human) Recombinant Protein
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*