Ver mas grande
PDGFA (Human) Recombinant Protein
AB-P4567
Producto nuevo
PDGFA (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 10 ug |
| Gene Name | PDGFA |
| Gene Alias | PDGF-A|PDGF1 |
| Gene Description | platelet-derived growth factor alpha polypeptide |
| Storage Conditions | Store at -20ºC or -80ºC.<br>After reconstitution with 0.1 mL of sterilized water, store at -20ºC or -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from a sterile filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Gene ID | 5154 |
Más información
Human PDGFA (P04085) recombinant protein expressed in Escherichia coli.