PDGFA (Human) Recombinant Protein View larger

Human PDGFA (P04085) recombinant protein expressed in <i>Escherichia coli</i>.

AB-P4567

New product

PDGFA (Human) Recombinant Protein

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 10 ug
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Store at -20ºC or -80ºC.<br>After reconstitution with 0.1 mL of sterilized water, store at -20ºC or -80ºC.<br>Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer Lyophilized from a sterile filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Gene ID 5154

More info

Human PDGFA (P04085) recombinant protein expressed in Escherichia coli.

Enviar uma mensagem

Human PDGFA (P04085) recombinant protein expressed in <i>Escherichia coli</i>.

Human PDGFA (P04085) recombinant protein expressed in <i>Escherichia coli</i>.