View larger
Human PDGFA (P04085) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4567
New product
PDGFA (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 10 ug |
| Gene Name | PDGFA |
| Gene Alias | PDGF-A|PDGF1 |
| Gene Description | platelet-derived growth factor alpha polypeptide |
| Storage Conditions | Store at -20ºC or -80ºC.<br>After reconstitution with 0.1 mL of sterilized water, store at -20ºC or -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | Lyophilized from a sterile filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA). |
| Gene ID | 5154 |
More info
Human PDGFA (P04085) recombinant protein expressed in Escherichia coli.