Ver mas grande
PSMF1 (Human) Recombinant Protein
AB-P4540
Producto nuevo
PSMF1 (Human) Recombinant Protein
Comprando este producto generará 4 Biopuntos. Su cesta contiene un total 4 Biopuntos puede ser convertido en un Biobonos Descuento 16.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PSMF1 |
| Gene Alias | PI31 |
| Gene Description | proteasome (prosome, macropain) inhibitor subunit 1 (PI31) |
| Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Concentration | 0.5 mg/mL |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPG |
| Form | Liquid |
| Antigen species Target species | Human |
| Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT, 0.1 mM PMSF). |
| Gene ID | 9491 |
Más información
Human PSMF1 (NP_006805, 1 a.a. - 271 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.