AB-P4540
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 4 pontos de fidelização. Seu carrinho totalizará 4 pontos de fidelização que podem ser convertidos num vale de desconto de 16.00EUR.
Size | 100 ug |
Gene Name | PSMF1 |
Gene Alias | PI31 |
Gene Description | proteasome (prosome, macropain) inhibitor subunit 1 (PI31) |
Storage Conditions | Store at 2ºC to 8ºC for 1 week. For long term storage, aliquot and store at -20ºC to -80ºC.<br>Aliquot to avoid repeated freezing and thawing. |
Concentration | 0.5 mg/mL |
Application Key | Func,SDS-PAGE |
Immunogen Prot. Seq | MGSSHHHHHHSSGLVPRGSHMAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYCGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPG |
Form | Liquid |
Antigen species Target species | Human |
Quality control testing | 15% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | In 20 mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1 mM DTT, 0.1 mM PMSF). |
Gene ID | 9491 |