Csf1r (Mouse) Recombinant Protein
  • Csf1r (Mouse) Recombinant Protein

Csf1r (Mouse) Recombinant Protein

Ref: AB-P4534
Csf1r (Mouse) Recombinant Protein

Información del producto

Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
Información adicional
Size 2 ug
Gene Name Csf1r
Gene Alias AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR
Gene Description colony stimulating factor 1 receptor
Storage Conditions Store at -80C. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD
Antigen species Target species Mouse
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 12978

Enviar un mensaje


Csf1r (Mouse) Recombinant Protein

Csf1r (Mouse) Recombinant Protein