Csf1r (Mouse) Recombinant Protein Ver mas grande

Csf1r (Mouse) Recombinant Protein

AB-P4534

Producto nuevo

Csf1r (Mouse) Recombinant Protein

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 2 ug
Gene Name Csf1r
Gene Alias AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR
Gene Description colony stimulating factor 1 receptor
Storage Conditions Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,WB-Re,AP,Array
Immunogen Prot. Seq ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD
Antigen species Target species Mouse
Quality control testing 12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID 12978

Más información

Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.

Consulta sobre un producto

Csf1r (Mouse) Recombinant Protein

Csf1r (Mouse) Recombinant Protein