View larger
Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.
AB-P4534
New product
Csf1r (Mouse) Recombinant Protein
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 2 ug |
| Gene Name | Csf1r |
| Gene Alias | AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR |
| Gene Description | colony stimulating factor 1 receptor |
| Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Application Key | ELISA,WB-Re,AP,Array |
| Immunogen Prot. Seq | ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD |
| Antigen species Target species | Mouse |
| Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
| Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene ID | 12978 |
More info
Mouse Csf1r partial ORF (NP_001032948.2, 133 a.a. - 241 a.a.) recombinant protein with GST-tag at N-terminal.