AB-P4534
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 2 ug |
Gene Name | Csf1r |
Gene Alias | AI323359|CD115|CSF-1R|Csfmr|Fim-2|Fms|M-CSFR |
Gene Description | colony stimulating factor 1 receptor |
Storage Conditions | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
Application Key | ELISA,WB-Re,AP,Array |
Immunogen Prot. Seq | ALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGD |
Antigen species Target species | Mouse |
Quality control testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
Storage Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID | 12978 |