Ver mas grande
IL25 (Human) Recombinant Protein
AB-P4408
Producto nuevo
IL25 (Human) Recombinant Protein
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 25 ug |
| Gene Name | IL25 |
| Gene Alias | IL-17E|IL-25|IL17E |
| Gene Description | interleukin 25 |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized 10 mM HCl, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Storage Buffer | No additive |
| Gene ID | 64806 |
Más información
Human IL25 (Q9H293) recombinant protein expressed in Escherichia coli.