IL25 (Human) Recombinant Protein
  • IL25 (Human) Recombinant Protein

IL25 (Human) Recombinant Protein

Ref: AB-P4408
IL25 (Human) Recombinant Protein

Información del producto

Human IL25 (Q9H293) recombinant protein expressed in Escherichia coli.
Información adicional
Size 25 ug
Gene Name IL25
Gene Alias IL-17E|IL-25|IL17E
Gene Description interleukin 25
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized 10 mM HCl, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq MYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Form Lyophilized
Antigen species Target species Human
Storage Buffer No additive
Gene ID 64806

Enviar uma mensagem


IL25 (Human) Recombinant Protein

IL25 (Human) Recombinant Protein