IGF2 (Human) Recombinant Protein
  • IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein

Ref: AB-P4401
IGF2 (Human) Recombinant Protein

Información del producto

Human IGF2 (P01344) recombinant protein expressed in Escherichia coli.
Información adicional
Size 50 ug
Gene Name IGF2
Gene Alias C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974
Gene Description insulin-like growth factor 2 (somatomedin A)
Storage Conditions Store at -20C on dry atmosphere.
After reconstitution with sterilized water, store at -20C or lower.
Aliquot to avoid repeated freezing and thawing.
Application Key Func,SDS-PAGE
Immunogen Prot. Seq AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Form Lyophilized
Antigen species Target species Human
Quality control testing 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Storage Buffer No additive
Gene ID 3481

Enviar un mensaje


IGF2 (Human) Recombinant Protein

IGF2 (Human) Recombinant Protein