View larger
Human IGF2 (P01344) recombinant protein expressed in <i>Escherichia coli</i>.
AB-P4401
New product
IGF2 (Human) Recombinant Protein
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 ug |
| Gene Name | IGF2 |
| Gene Alias | C11orf43|FLJ22066|FLJ44734|INSIGF|pp9974 |
| Gene Description | insulin-like growth factor 2 (somatomedin A) |
| Storage Conditions | Store at -20ºC on dry atmosphere.<br>After reconstitution with sterilized water, store at -20ºC or lower.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | Func,SDS-PAGE |
| Immunogen Prot. Seq | AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
| Form | Lyophilized |
| Antigen species Target species | Human |
| Quality control testing | 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue |
| Storage Buffer | No additive |
| Gene ID | 3481 |
More info
Human IGF2 (P01344) recombinant protein expressed in Escherichia coli.